KLF3 polyclonal antibody (A01)
  • KLF3 polyclonal antibody (A01)

KLF3 polyclonal antibody (A01)

Ref: AB-H00051274-A01
KLF3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KLF3.
Información adicional
Size 50 uL
Gene Name KLF3
Gene Alias BKLF|MGC48279
Gene Description Kruppel-like factor 3 (basic)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDLTVNKR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF3 (NP_057615, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51274

Enviar un mensaje


KLF3 polyclonal antibody (A01)

KLF3 polyclonal antibody (A01)