PIPOX purified MaxPab rabbit polyclonal antibody (D01P)
  • PIPOX purified MaxPab rabbit polyclonal antibody (D01P)

PIPOX purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051268-D01P
PIPOX purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PIPOX protein.
Información adicional
Size 100 ug
Gene Name PIPOX
Gene Alias LPIPOX
Gene Description pipecolic acid oxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLGLCPHH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PIPOX (NP_057602.2, 1 a.a. ~ 390 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51268

Enviar un mensaje


PIPOX purified MaxPab rabbit polyclonal antibody (D01P)

PIPOX purified MaxPab rabbit polyclonal antibody (D01P)