CDKL3 monoclonal antibody (M03), clone 4F1
  • CDKL3 monoclonal antibody (M03), clone 4F1

CDKL3 monoclonal antibody (M03), clone 4F1

Ref: AB-H00051265-M03
CDKL3 monoclonal antibody (M03), clone 4F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDKL3.
Información adicional
Size 100 ug
Gene Name CDKL3
Gene Alias NKIAMRE
Gene Description cyclin-dependent kinase-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NELRKDERKTVYTNTLLSSSVLGKEIEKEKKPKEIKVRVIKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKLVTIEPPNPINPSTNCNGLKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDKL3 (AAH41799.1, 322 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51265
Clone Number 4F1
Iso type IgG2a Kappa

Enviar un mensaje


CDKL3 monoclonal antibody (M03), clone 4F1

CDKL3 monoclonal antibody (M03), clone 4F1