MARCH2 purified MaxPab mouse polyclonal antibody (B01P)
  • MARCH2 purified MaxPab mouse polyclonal antibody (B01P)

MARCH2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051257-B01P
MARCH2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MARCH2 protein.
Información adicional
Size 50 ug
Gene Name MARCH2
Gene Alias HSPC240|MARCH-II|RNF172
Gene Description membrane-associated ring finger (C3HC4) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MARCH2 (NP_001005416.1, 1 a.a. ~ 176 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51257

Enviar un mensaje


MARCH2 purified MaxPab mouse polyclonal antibody (B01P)

MARCH2 purified MaxPab mouse polyclonal antibody (B01P)