RNF181 purified MaxPab rabbit polyclonal antibody (D01P)
  • RNF181 purified MaxPab rabbit polyclonal antibody (D01P)

RNF181 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051255-D01P
RNF181 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RNF181 protein.
Información adicional
Size 100 ug
Gene Name RNF181
Gene Alias HSPC238
Gene Description ring finger protein 181
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti
Immunogen Prot. Seq MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian tissue lysate.
Immunogen RNF181 (NP_057578.1, 1 a.a. ~ 153 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51255

Enviar un mensaje


RNF181 purified MaxPab rabbit polyclonal antibody (D01P)

RNF181 purified MaxPab rabbit polyclonal antibody (D01P)