PACAP purified MaxPab mouse polyclonal antibody (B01P)
  • PACAP purified MaxPab mouse polyclonal antibody (B01P)

PACAP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051237-B01P
PACAP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PACAP protein.
Información adicional
Size 50 ug
Gene Name MGC29506
Gene Alias FLJ32987|PACAP
Gene Description hypothetical protein MGC29506
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PACAP (AAH21275, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51237

Enviar un mensaje


PACAP purified MaxPab mouse polyclonal antibody (B01P)

PACAP purified MaxPab mouse polyclonal antibody (B01P)