CRIM1 monoclonal antibody (M01), clone 6E4
  • CRIM1 monoclonal antibody (M01), clone 6E4

CRIM1 monoclonal antibody (M01), clone 6E4

Ref: AB-H00051232-M01
CRIM1 monoclonal antibody (M01), clone 6E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CRIM1.
Información adicional
Size 100 ug
Gene Name CRIM1
Gene Alias MGC138194|S52
Gene Description cysteine rich transmembrane BMP regulator 1 (chordin-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CRIM1 (NP_057525, 36 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51232
Clone Number 6E4
Iso type IgG2a Kappa

Enviar un mensaje


CRIM1 monoclonal antibody (M01), clone 6E4

CRIM1 monoclonal antibody (M01), clone 6E4