GLTP polyclonal antibody (A01)
  • GLTP polyclonal antibody (A01)

GLTP polyclonal antibody (A01)

Ref: AB-H00051228-A01
GLTP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GLTP.
Información adicional
Size 50 uL
Gene Name GLTP
Gene Alias -
Gene Description glycolipid transfer protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLTP (NP_057517, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51228

Enviar un mensaje


GLTP polyclonal antibody (A01)

GLTP polyclonal antibody (A01)