TCEB3B purified MaxPab mouse polyclonal antibody (B01P)
  • TCEB3B purified MaxPab mouse polyclonal antibody (B01P)

TCEB3B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051224-B01P
TCEB3B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TCEB3B protein.
Información adicional
Size 50 ug
Gene Name TCEB3B
Gene Alias ELOA2|HsT832|MGC119351|TCEB3L
Gene Description transcription elongation factor B polypeptide 3B (elongin A2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAGSTTLHAVEKLQVRLATKTEPKKLEKYLQKLSALLMTADILAETGIRKTVKRLRKHQHVGDFARDLAARWKKLVLVDRNTRPGPQDPEESASRQRFGEALQDQEKAWGFPENATAPRSPSHSPEHRRTARRTPPGQQRPHPRSHSREPRAERKCPRIAPADSGRYRASPTRTAPLPMPEGPEPAAPGKQPGRGHTHAAQGGPLLCPGCQGQPQGKAVVSHSKGHKSSRQEKRPLCAQGDWHSPTLIREKSFG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TCEB3B (AAI03912.1, 1 a.a. ~ 753 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51224

Enviar un mensaje


TCEB3B purified MaxPab mouse polyclonal antibody (B01P)

TCEB3B purified MaxPab mouse polyclonal antibody (B01P)