RAPGEFL1 monoclonal antibody (M04), clone 4G2
  • RAPGEFL1 monoclonal antibody (M04), clone 4G2

RAPGEFL1 monoclonal antibody (M04), clone 4G2

Ref: AB-H00051195-M04
RAPGEFL1 monoclonal antibody (M04), clone 4G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAPGEFL1.
Información adicional
Size 100 ug
Gene Name RAPGEFL1
Gene Alias Link-GEFII|MGC134798|MGC134799
Gene Description Rap guanine nucleotide exchange factor (GEF)-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEGPEGLGRKQACLAMLLHFLDTYQGLLQEEEGAGHIIKDLYLLIMKDESLYQGLREDTLRLHQLVETVELKIPEENQPPSKQVKPLFRHFRRIDSCLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAPGEFL1 (NP_057423, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51195
Clone Number 4G2
Iso type IgG2a Kappa

Enviar un mensaje


RAPGEFL1 monoclonal antibody (M04), clone 4G2

RAPGEFL1 monoclonal antibody (M04), clone 4G2