HERC5 polyclonal antibody (A01)
  • HERC5 polyclonal antibody (A01)

HERC5 polyclonal antibody (A01)

Ref: AB-H00051191-A01
HERC5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HERC5.
Información adicional
Size 50 uL
Gene Name HERC5
Gene Alias CEB1|CEBP1
Gene Description hect domain and RLD 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HERC5 (NP_057407, 915 a.a. ~ 1024 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51191

Enviar un mensaje


HERC5 polyclonal antibody (A01)

HERC5 polyclonal antibody (A01)