C15orf15 monoclonal antibody (M01), clone 2A10-1E5
  • C15orf15 monoclonal antibody (M01), clone 2A10-1E5

C15orf15 monoclonal antibody (M01), clone 2A10-1E5

Ref: AB-H00051187-M01
C15orf15 monoclonal antibody (M01), clone 2A10-1E5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant C15orf15.
Información adicional
Size 100 ug
Gene Name C15orf15
Gene Alias HRP-L30-iso|L30|RLP24|RPL24|RPL24L|TVAS3
Gene Description chromosome 15 open reading frame 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C15orf15 (AAH05344, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51187
Clone Number 2A10-1E5
Iso type IgG1 kappa

Enviar un mensaje


C15orf15 monoclonal antibody (M01), clone 2A10-1E5

C15orf15 monoclonal antibody (M01), clone 2A10-1E5