PLEKHO1 purified MaxPab mouse polyclonal antibody (B01P)
  • PLEKHO1 purified MaxPab mouse polyclonal antibody (B01P)

PLEKHO1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051177-B01P
PLEKHO1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PLEKHO1 protein.
Información adicional
Size 50 ug
Gene Name PLEKHO1
Gene Alias CKIP-1|OC120
Gene Description pleckstrin homology domain containing, family O member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVDLDKSVAQLAGSRRRADSDRIQPSADRASSLSRPWEKTDKGATYTP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLEKHO1 (NP_057358.2, 1 a.a. ~ 409 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51177

Enviar un mensaje


PLEKHO1 purified MaxPab mouse polyclonal antibody (B01P)

PLEKHO1 purified MaxPab mouse polyclonal antibody (B01P)