LEF1 monoclonal antibody (M06), clone 1A8
  • LEF1 monoclonal antibody (M06), clone 1A8

LEF1 monoclonal antibody (M06), clone 1A8

Ref: AB-H00051176-M06
LEF1 monoclonal antibody (M06), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant LEF1.
Información adicional
Size 100 ug
Gene Name LEF1
Gene Alias DKFZp586H0919|TCF1ALPHA
Gene Description lymphoid enhancer-binding factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq QKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LEF1 (NP_057353, 33 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51176
Clone Number 1A8
Iso type IgG2a Kappa

Enviar un mensaje


LEF1 monoclonal antibody (M06), clone 1A8

LEF1 monoclonal antibody (M06), clone 1A8