LEF1 monoclonal antibody (M05), clone 1H2
  • LEF1 monoclonal antibody (M05), clone 1H2

LEF1 monoclonal antibody (M05), clone 1H2

Ref: AB-H00051176-M05
LEF1 monoclonal antibody (M05), clone 1H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LEF1.
Información adicional
Size 100 ug
Gene Name LEF1
Gene Alias DKFZp586H0919|TCF1ALPHA
Gene Description lymphoid enhancer-binding factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNND
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LEF1 (NP_057353, 14 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51176
Clone Number 1H2
Iso type IgG1 Kappa

Enviar un mensaje


LEF1 monoclonal antibody (M05), clone 1H2

LEF1 monoclonal antibody (M05), clone 1H2