NAGPA polyclonal antibody (A01)
  • NAGPA polyclonal antibody (A01)

NAGPA polyclonal antibody (A01)

Ref: AB-H00051172-A01
NAGPA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NAGPA.
Información adicional
Size 50 uL
Gene Name NAGPA
Gene Alias APAA|UCE
Gene Description N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPGCDELDCGPSNCSQHGLCTETGCRCDAGWTGSNCSEECPLGWHGPGCQRPCKC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NAGPA (NP_057340, 309 a.a. ~ 408 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51172

Enviar un mensaje


NAGPA polyclonal antibody (A01)

NAGPA polyclonal antibody (A01)