Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
AADAT MaxPab rabbit polyclonal antibody (D01)
Abnova
AADAT MaxPab rabbit polyclonal antibody (D01)
Ref: AB-H00051166-D01
AADAT MaxPab rabbit polyclonal antibody (D01)
Contáctenos
Información del producto
Rabbit polyclonal antibody raised against a full-length human AADAT protein.
Información adicional
Size
100 uL
Gene Name
AADAT
Gene Alias
KAT2|KATII
Gene Description
aminoadipate aminotransferase
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,IP
Immunogen Prot. Seq
MNYARFITAASAARNPSPIRTMSEKRADILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDV
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
AADAT (AAH31068.1, 1 a.a. ~ 429 a.a) full-length human protein.
Storage Buffer
No additive
Gene ID
51166
Enviar un mensaje
AADAT MaxPab rabbit polyclonal antibody (D01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*