EGFL7 purified MaxPab mouse polyclonal antibody (B01P)
  • EGFL7 purified MaxPab mouse polyclonal antibody (B01P)

EGFL7 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051162-B01P
EGFL7 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EGFL7 protein.
Información adicional
Size 50 ug
Gene Name EGFL7
Gene Alias MGC111117|RP11-251M1.2|VE-STATIN|ZNEU1
Gene Description EGF-like-domain, multiple 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EGFL7 (NP_057299.1, 1 a.a. ~ 273 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51162

Enviar un mensaje


EGFL7 purified MaxPab mouse polyclonal antibody (B01P)

EGFL7 purified MaxPab mouse polyclonal antibody (B01P)