SERPINA10 purified MaxPab mouse polyclonal antibody (B01P)
  • SERPINA10 purified MaxPab mouse polyclonal antibody (B01P)

SERPINA10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051156-B01P
SERPINA10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SERPINA10 protein.
Información adicional
Size 50 ug
Gene Name SERPINA10
Gene Alias PZI|ZPI
Gene Description serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SERPINA10 (NP_057270.1, 1 a.a. ~ 444 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51156

Enviar un mensaje


SERPINA10 purified MaxPab mouse polyclonal antibody (B01P)

SERPINA10 purified MaxPab mouse polyclonal antibody (B01P)