SERPINA10 polyclonal antibody (A01)
  • SERPINA10 polyclonal antibody (A01)

SERPINA10 polyclonal antibody (A01)

Ref: AB-H00051156-A01
SERPINA10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SERPINA10.
Información adicional
Size 50 uL
Gene Name SERPINA10
Gene Alias PZI|ZPI
Gene Description serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERPINA10 (AAH22261, 22 a.a. ~ 444 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51156

Enviar un mensaje


SERPINA10 polyclonal antibody (A01)

SERPINA10 polyclonal antibody (A01)