MRTO4 MaxPab rabbit polyclonal antibody (D01)
  • MRTO4 MaxPab rabbit polyclonal antibody (D01)

MRTO4 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051154-D01
MRTO4 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MRTO4 protein.
Información adicional
Size 100 uL
Gene Name MRTO4
Gene Alias C1orf33|MRT4|dJ657E11.4
Gene Description mRNA turnover 4 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRTO4 (NP_057267.2, 1 a.a. ~ 239 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51154

Enviar un mensaje


MRTO4 MaxPab rabbit polyclonal antibody (D01)

MRTO4 MaxPab rabbit polyclonal antibody (D01)