SLC45A2 purified MaxPab rabbit polyclonal antibody (D01P)
  • SLC45A2 purified MaxPab rabbit polyclonal antibody (D01P)

SLC45A2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051151-D01P
SLC45A2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SLC45A2 protein.
Información adicional
Size 100 ug
Gene Name SLC45A2
Gene Alias 1A1|AIM1|MATP|SHEP5
Gene Description solute carrier family 45, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTGFGGALGYLLGAIDWAHLELGRLLGTEFQVMFFFSALVLTLCFTVHLCSISEAPLTEVAKGIPPQQTP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC45A2 (NP_001012527.1, 1 a.a. ~ 460 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51151

Enviar un mensaje


SLC45A2 purified MaxPab rabbit polyclonal antibody (D01P)

SLC45A2 purified MaxPab rabbit polyclonal antibody (D01P)