HSD17B12 polyclonal antibody (A01)
  • HSD17B12 polyclonal antibody (A01)

HSD17B12 polyclonal antibody (A01)

Ref: AB-H00051144-A01
HSD17B12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HSD17B12.
Información adicional
Size 50 uL
Gene Name HSD17B12
Gene Alias KAR|SDR12C1
Gene Description hydroxysteroid (17-beta) dehydrogenase 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HSD17B12 (NP_057226, 203 a.a. ~ 271 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51144

Enviar un mensaje


HSD17B12 polyclonal antibody (A01)

HSD17B12 polyclonal antibody (A01)