LOC51136 monoclonal antibody (M01), clone 4H7
  • LOC51136 monoclonal antibody (M01), clone 4H7

LOC51136 monoclonal antibody (M01), clone 4H7

Ref: AB-H00051136-M01
LOC51136 monoclonal antibody (M01), clone 4H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LOC51136.
Información adicional
Size 100 ug
Gene Name RNFT1
Gene Alias MGC111090|PTD016
Gene Description ring finger protein, transmembrane 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MQANRSQLHSPPGTGSSEDASTPQCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LOC51136 (NP_057209, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51136
Clone Number 4H7
Iso type IgG2a Kappa

Enviar un mensaje


LOC51136 monoclonal antibody (M01), clone 4H7

LOC51136 monoclonal antibody (M01), clone 4H7