LOC51136 polyclonal antibody (A01)
  • LOC51136 polyclonal antibody (A01)

LOC51136 polyclonal antibody (A01)

Ref: AB-H00051136-A01
LOC51136 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LOC51136.
Información adicional
Size 50 uL
Gene Name RNFT1
Gene Alias MGC111090|PTD016
Gene Description ring finger protein, transmembrane 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MQANRSQLHSPPGTGSSEDASTPQCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LOC51136 (NP_057209, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51136

Enviar un mensaje


LOC51136 polyclonal antibody (A01)

LOC51136 polyclonal antibody (A01)