RNF12 monoclonal antibody (M01), clone 1G10
  • RNF12 monoclonal antibody (M01), clone 1G10

RNF12 monoclonal antibody (M01), clone 1G10

Ref: AB-H00051132-M01
RNF12 monoclonal antibody (M01), clone 1G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNF12.
Información adicional
Size 100 ug
Gene Name RNF12
Gene Alias MGC15161|NY-REN-43|RLIM
Gene Description ring finger protein 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51132
Clone Number 1G10
Iso type IgG2a Kappa

Enviar un mensaje


RNF12 monoclonal antibody (M01), clone 1G10

RNF12 monoclonal antibody (M01), clone 1G10