NAT5 monoclonal antibody (M01), clone 2C6
  • NAT5 monoclonal antibody (M01), clone 2C6

NAT5 monoclonal antibody (M01), clone 2C6

Ref: AB-H00051126-M01
NAT5 monoclonal antibody (M01), clone 2C6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NAT5.
Información adicional
Size 100 ug
Gene Name NAT5
Gene Alias NAT3|dJ1002M8.1
Gene Description N-acetyltransferase 5 (GCN5-related, putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NAT5 (AAH05181, 1 a.a. ~ 178 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51126
Clone Number 2C6
Iso type IgG1 Kappa

Enviar un mensaje


NAT5 monoclonal antibody (M01), clone 2C6

NAT5 monoclonal antibody (M01), clone 2C6