TTC15 purified MaxPab mouse polyclonal antibody (B01P)
  • TTC15 purified MaxPab mouse polyclonal antibody (B01P)

TTC15 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051112-B01P
TTC15 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TTC15 protein.
Información adicional
Size 50 ug
Gene Name TTC15
Gene Alias CGI-87|DKFZp547E107|FLJ36862
Gene Description tetratricopeptide repeat domain 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MEDAGGGEETPAPEAPHPPQLAPPEEQGLLFQEETIDLGGDEFGSEENETASEGSSPLADKLNEHMMESVLISDSPNSEGDAGDLGRVRDEAEPGGEGDPGPEPAGTPSPSGEADGDCAPEDAAPSSGGAPRQDAAREVPGSEAARPEQEPPVAEPVPVCTIFSQRAPPASGDGFEPQMVKSPSFGGASEASARTPPQVVQPSPSLSTFFGDTAASHSLASDFFDSFTTSAFISVSNPGAGSPAPASPPPLAVPG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TTC15 (AAH14164.2, 1 a.a. ~ 735 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51112

Enviar un mensaje


TTC15 purified MaxPab mouse polyclonal antibody (B01P)

TTC15 purified MaxPab mouse polyclonal antibody (B01P)