MECR purified MaxPab rabbit polyclonal antibody (D01P)
  • MECR purified MaxPab rabbit polyclonal antibody (D01P)

MECR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051102-D01P
MECR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MECR protein.
Información adicional
Size 100 ug
Gene Name MECR
Gene Alias CGI-63|FASN2B|NRBF1
Gene Description mitochondrial trans-2-enoyl-CoA reductase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MECR (NP_057095.2, 1 a.a. ~ 373 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51102

Enviar un mensaje


MECR purified MaxPab rabbit polyclonal antibody (D01P)

MECR purified MaxPab rabbit polyclonal antibody (D01P)