NDUFA13 purified MaxPab mouse polyclonal antibody (B02P)
  • NDUFA13 purified MaxPab mouse polyclonal antibody (B02P)

NDUFA13 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00051079-B02P
NDUFA13 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NDUFA13 protein.
Información adicional
Size 50 ug
Gene Name NDUFA13
Gene Alias B16.6|CDA016|CGI-39|GRIM-19|GRIM19
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IHC-P,IF
Immunogen Prot. Seq MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFA13 (AAH09189.1, 1 a.a. ~ 144 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51079

Enviar un mensaje


NDUFA13 purified MaxPab mouse polyclonal antibody (B02P)

NDUFA13 purified MaxPab mouse polyclonal antibody (B02P)