THAP4 purified MaxPab mouse polyclonal antibody (B01P)
  • THAP4 purified MaxPab mouse polyclonal antibody (B01P)

THAP4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051078-B01P
THAP4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human THAP4 protein.
Información adicional
Size 50 ug
Gene Name THAP4
Gene Alias CGI-36
Gene Description THAP domain containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MVICCAAVNCSNRQGKGEKRAVSFHRFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHFTKDSFSKRLEDQHRLLKPTAVPSIFHLTEKKRGAGGHGRTRRKDASKATGGVRGHSSAATGRGAAGWSPSSSGNPMAKPESRRLKQAALQGEATPRAAQEAASQEQAQQALERTPGDGLATMVAGSQGKAEASATDAGDESATSSIEGGVTDKSGISMDDFTPPGSGACKFIGSLHSYSFSSKHTRERPSVPREP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen THAP4 (NP_057047.3, 1 a.a. ~ 577 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51078

Enviar un mensaje


THAP4 purified MaxPab mouse polyclonal antibody (B01P)

THAP4 purified MaxPab mouse polyclonal antibody (B01P)