GMNN monoclonal antibody (M02), clone 1B10
  • GMNN monoclonal antibody (M02), clone 1B10

GMNN monoclonal antibody (M02), clone 1B10

Ref: AB-H00051053-M02
GMNN monoclonal antibody (M02), clone 1B10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GMNN.
Información adicional
Size 100 ug
Gene Name GMNN
Gene Alias Gem|RP3-369A17.3
Gene Description geminin, DNA replication inhibitor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51053
Clone Number 1B10
Iso type IgG2a Kappa

Enviar un mensaje


GMNN monoclonal antibody (M02), clone 1B10

GMNN monoclonal antibody (M02), clone 1B10