PI15 monoclonal antibody (M02), clone 3B5
  • PI15 monoclonal antibody (M02), clone 3B5

PI15 monoclonal antibody (M02), clone 3B5

Ref: AB-H00051050-M02
PI15 monoclonal antibody (M02), clone 3B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PI15.
Información adicional
Size 100 ug
Gene Name PI15
Gene Alias CRISP8|DKFZp686F0366|P24TI|P25TI
Gene Description peptidase inhibitor 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq EASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PI15 (NP_056970, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51050
Clone Number 3B5
Iso type IgG1 Kappa

Enviar un mensaje


PI15 monoclonal antibody (M02), clone 3B5

PI15 monoclonal antibody (M02), clone 3B5