PI15 purified MaxPab mouse polyclonal antibody (B01P)
  • PI15 purified MaxPab mouse polyclonal antibody (B01P)

PI15 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051050-B01P
PI15 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PI15 protein.
Información adicional
Size 50 ug
Gene Name PI15
Gene Alias CRISP8|DKFZp686F0366|P24TI|P25TI
Gene Description peptidase inhibitor 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PI15 (NP_056970.1, 1 a.a. ~ 258 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51050

Enviar un mensaje


PI15 purified MaxPab mouse polyclonal antibody (B01P)

PI15 purified MaxPab mouse polyclonal antibody (B01P)