ZBTB7B monoclonal antibody (M03), clone 1D4
  • ZBTB7B monoclonal antibody (M03), clone 1D4

ZBTB7B monoclonal antibody (M03), clone 1D4

Ref: AB-H00051043-M03
ZBTB7B monoclonal antibody (M03), clone 1D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ZBTB7B.
Información adicional
Size 100 ug
Gene Name ZBTB7B
Gene Alias DKFZp686G01254|THPOK|ZBTB15|ZFP67|ZNF857B|c-Krox|hcKrox
Gene Description zinc finger and BTB domain containing 7B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ZBTB7B (NP_056956.1, 433 a.a. ~ 537 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51043
Clone Number 1D4
Iso type IgG2a Kappa

Enviar un mensaje


ZBTB7B monoclonal antibody (M03), clone 1D4

ZBTB7B monoclonal antibody (M03), clone 1D4