BOLA1 monoclonal antibody (M07), clone 2H3
  • BOLA1 monoclonal antibody (M07), clone 2H3

BOLA1 monoclonal antibody (M07), clone 2H3

Ref: AB-H00051027-M07
BOLA1 monoclonal antibody (M07), clone 2H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BOLA1.
Información adicional
Size 100 ug
Gene Name BOLA1
Gene Alias CGI-143|MGC75015|RP11-196G18.18
Gene Description bolA homolog 1 (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BOLA1 (NP_057158, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51027
Clone Number 2H3
Iso type IgG1 Kappa

Enviar un mensaje


BOLA1 monoclonal antibody (M07), clone 2H3

BOLA1 monoclonal antibody (M07), clone 2H3