GLRX2 polyclonal antibody (A01)
  • GLRX2 polyclonal antibody (A01)

GLRX2 polyclonal antibody (A01)

Ref: AB-H00051022-A01
GLRX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant GLRX2.
Información adicional
Size 50 uL
Gene Name GLRX2
Gene Alias GRX2|bA101E13.1
Gene Description glutaredoxin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GLRX2 (AAH28113, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51022

Enviar un mensaje


GLRX2 polyclonal antibody (A01)

GLRX2 polyclonal antibody (A01)