EXOSC3 purified MaxPab rabbit polyclonal antibody (D01P)
  • EXOSC3 purified MaxPab rabbit polyclonal antibody (D01P)

EXOSC3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051010-D01P
EXOSC3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EXOSC3 protein.
Información adicional
Size 100 ug
Gene Name EXOSC3
Gene Alias CGI-102|MGC15120|MGC723|RP11-3J10.8|RRP40|Rrp40p|bA3J10.7|hRrp40p|p10
Gene Description exosome component 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EXOSC3 (NP_057126.2, 1 a.a. ~ 275 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51010

Enviar un mensaje


EXOSC3 purified MaxPab rabbit polyclonal antibody (D01P)

EXOSC3 purified MaxPab rabbit polyclonal antibody (D01P)