MED31 monoclonal antibody (M01A), clone 2C8
  • MED31 monoclonal antibody (M01A), clone 2C8

MED31 monoclonal antibody (M01A), clone 2C8

Ref: AB-H00051003-M01A
MED31 monoclonal antibody (M01A), clone 2C8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MED31.
Información adicional
Size 200 uL
Gene Name MED31
Gene Alias 3110004H13Rik|CGI-125|FLJ27436|FLJ36714|Soh1
Gene Description mediator complex subunit 31
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MED31 (AAH12539, 1 a.a. ~ 131 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 51003
Clone Number 2C8
Iso type IgG2b Kappa

Enviar un mensaje


MED31 monoclonal antibody (M01A), clone 2C8

MED31 monoclonal antibody (M01A), clone 2C8