CGI-121 monoclonal antibody (M01), clone 3F6
  • CGI-121 monoclonal antibody (M01), clone 3F6

CGI-121 monoclonal antibody (M01), clone 3F6

Ref: AB-H00051002-M01
CGI-121 monoclonal antibody (M01), clone 3F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CGI-121.
Información adicional
Size 100 ug
Gene Name TPRKB
Gene Alias CGI-121
Gene Description TP53RK binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CGI-121 (NP_057142, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51002
Clone Number 3F6
Iso type IgG1 Kappa

Enviar un mensaje


CGI-121 monoclonal antibody (M01), clone 3F6

CGI-121 monoclonal antibody (M01), clone 3F6