TPRKB purified MaxPab rabbit polyclonal antibody (D01P)
  • TPRKB purified MaxPab rabbit polyclonal antibody (D01P)

TPRKB purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051002-D01P
TPRKB purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TPRKB protein.
Información adicional
Size 100 ug
Gene Name TPRKB
Gene Alias CGI-121
Gene Description TP53RK binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TPRKB (NP_057142.1, 1 a.a. ~ 175 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51002

Enviar un mensaje


TPRKB purified MaxPab rabbit polyclonal antibody (D01P)

TPRKB purified MaxPab rabbit polyclonal antibody (D01P)