CGI-121 polyclonal antibody (A01)
  • CGI-121 polyclonal antibody (A01)

CGI-121 polyclonal antibody (A01)

Ref: AB-H00051002-A01
CGI-121 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CGI-121.
Información adicional
Size 50 uL
Gene Name TPRKB
Gene Alias CGI-121
Gene Description TP53RK binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CGI-121 (NP_057142, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51002

Enviar un mensaje


CGI-121 polyclonal antibody (A01)

CGI-121 polyclonal antibody (A01)