TBX22 purified MaxPab rabbit polyclonal antibody (D01P)
  • TBX22 purified MaxPab rabbit polyclonal antibody (D01P)

TBX22 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00050945-D01P
TBX22 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TBX22 protein.
Información adicional
Size 100 ug
Gene Name TBX22
Gene Alias CLPA|TBXX|dJ795G23.1
Gene Description T-box 22
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MALSSRARAFSVEALVGRPSKRKLQDPIQAEQPELREKKGGEEEEERRSSAAGKSEPLEKQPKTEPSTSASSGCGSDSGYGNSSESLEEKDIQMELQGSELWKRFHDIGTEMIITKAGRRMFPSVRVKVKGLDPGKQYHVAIDVVPVDSKRYRYVYHSSQWMVAGNTDHLCIIPRFYVHPDSPCSGETWMRQIISFDRMKLTNNEMDDKGHIILQSMHKYKPRVHVIEQGSSVDLSQIQSLPTEGVKTFSFKETE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TBX22 (NP_058650.1, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50945

Enviar un mensaje


TBX22 purified MaxPab rabbit polyclonal antibody (D01P)

TBX22 purified MaxPab rabbit polyclonal antibody (D01P)