IMPG2 monoclonal antibody (M02), clone 3H5
  • IMPG2 monoclonal antibody (M02), clone 3H5

IMPG2 monoclonal antibody (M02), clone 3H5

Ref: AB-H00050939-M02
IMPG2 monoclonal antibody (M02), clone 3H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IMPG2.
Información adicional
Size 100 ug
Gene Name IMPG2
Gene Alias IPM200|SPACRCAN
Gene Description interphotoreceptor matrix proteoglycan 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IMPG2 (NP_057331.2, 572 a.a. ~ 678 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50939
Clone Number 3H5
Iso type IgG2a Kappa

Enviar un mensaje


IMPG2 monoclonal antibody (M02), clone 3H5

IMPG2 monoclonal antibody (M02), clone 3H5