HEBP1 polyclonal antibody (A01)
  • HEBP1 polyclonal antibody (A01)

HEBP1 polyclonal antibody (A01)

Ref: AB-H00050865-A01
HEBP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HEBP1.
Información adicional
Size 50 uL
Gene Name HEBP1
Gene Alias HBP|HEBP
Gene Description heme binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HEBP1 (NP_057071, 80 a.a. ~ 189 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 50865

Enviar un mensaje


HEBP1 polyclonal antibody (A01)

HEBP1 polyclonal antibody (A01)