HNT polyclonal antibody (A01)
  • HNT polyclonal antibody (A01)

HNT polyclonal antibody (A01)

Ref: AB-H00050863-A01
HNT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HNT.
Información adicional
Size 50 uL
Gene Name HNT
Gene Alias MGC60329|NTM
Gene Description neurotrimin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HNT (NP_057606, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 50863

Enviar un mensaje


HNT polyclonal antibody (A01)

HNT polyclonal antibody (A01)