SPOCK3 monoclonal antibody (M01), clone 1A10
  • SPOCK3 monoclonal antibody (M01), clone 1A10

SPOCK3 monoclonal antibody (M01), clone 1A10

Ref: AB-H00050859-M01
SPOCK3 monoclonal antibody (M01), clone 1A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SPOCK3.
Información adicional
Size 100 ug
Gene Name SPOCK3
Gene Alias HSAJ1454|TES-3
Gene Description sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq RGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPOCK3 (NP_058646, 132 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50859
Clone Number 1A10
Iso type IgG2b Kappa

Enviar un mensaje


SPOCK3 monoclonal antibody (M01), clone 1A10

SPOCK3 monoclonal antibody (M01), clone 1A10