SPOCK3 polyclonal antibody (A01)
  • SPOCK3 polyclonal antibody (A01)

SPOCK3 polyclonal antibody (A01)

Ref: AB-H00050859-A01
SPOCK3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPOCK3.
Información adicional
Size 50 uL
Gene Name SPOCK3
Gene Alias HSAJ1454|TES-3
Gene Description sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPOCK3 (NP_058646, 132 a.a. ~ 230 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 50859

Enviar un mensaje


SPOCK3 polyclonal antibody (A01)

SPOCK3 polyclonal antibody (A01)