DHH monoclonal antibody (M02), clone 2D5
  • DHH monoclonal antibody (M02), clone 2D5

DHH monoclonal antibody (M02), clone 2D5

Ref: AB-H00050846-M02
DHH monoclonal antibody (M02), clone 2D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DHH.
Información adicional
Size 100 ug
Gene Name DHH
Gene Alias HHG-3|MGC35145
Gene Description desert hedgehog homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,ELISA
Immunogen Prot. Seq SGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRP*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DHH (NP_066382, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50846
Clone Number 2D5
Iso type IgG2a Kappa

Enviar un mensaje


DHH monoclonal antibody (M02), clone 2D5

DHH monoclonal antibody (M02), clone 2D5