AK3 purified MaxPab rabbit polyclonal antibody (D01P)
  • AK3 purified MaxPab rabbit polyclonal antibody (D01P)

AK3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00050808-D01P
AK3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AK3 protein.
Información adicional
Size 100 ug
Gene Name AK3
Gene Alias AK3L1|AK6|AKL3L|AKL3L1|FIX
Gene Description adenylate kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AK3 (NP_057366.2, 1 a.a. ~ 227 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50808

Enviar un mensaje


AK3 purified MaxPab rabbit polyclonal antibody (D01P)

AK3 purified MaxPab rabbit polyclonal antibody (D01P)